PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA8G00331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family ARF
Protein Properties Length: 782aa    MW: 87290 Da    PI: 7.082
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA8G00331genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.82.4e-24177278199
                EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   +++++el++
  AA8G00331 177 FCKTLTASDTSTHGGFSVPRRAAEDCfapldyK-QQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RDEDGELRL 273
                99****************************963.3445679************************************************..5699999** PP

                EEE-S CS
         B3  95 kvfrk 99 
                +++r+
  AA8G00331 274 GIRRA 278
                **996 PP

2Auxin_resp121.18.4e-40302383182
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                 +a+a+stks+F+v+Y+Pra++++Fv+++ek+ +++++++++G+Rf+m+fe++d++err++G+v+g+ dldp+rWpnSkWr+L
   AA8G00331 302 VANAVSTKSMFHVFYSPRATHADFVIPYEKYISSIRNPICIGTRFRMRFEMDDCPERRCAGVVTGICDLDPYRWPNSKWRCL 383
                 689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.109.2E-41168291IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.44E-42171289IPR015300DNA-binding pseudobarrel domain
CDDcd100177.29E-21175277No hitNo description
PROSITE profilePS5086313.38177279IPR003340B3 DNA binding domain
PfamPF023622.4E-22177278IPR003340B3 DNA binding domain
SMARTSM010192.1E-23177279IPR003340B3 DNA binding domain
PfamPF065072.3E-33302383IPR010525Auxin response factor
SuperFamilySSF542777.19E-10657736No hitNo description
PROSITE profilePS5174521.654660742IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 782 aa     Download sequence    Send to blast
MEFDLNTEVT EVEEENDDVG VGGGGVVEKG RIGITPSSSS SCSSGSLSSC TASVSFSIYS  60
ELWHACAGPL TSLPKKGNVV VYFPQGHLEQ GLMASYSSSP LSPLEIPKFD LHPHILCRVV  120
NVHLLANKET DEVYTQITLL PLQEFSMANM EGKELRELGG DEERDGSSSV KRTPHMFCKT  180
LTASDTSTHG GFSVPRRAAE DCFAPLDYKQ QRPSQELIAK DLHGVEWKFR HIYRGQPRRH  240
LLTTGWSIFV SQKNLVSGDA VLFLRDEDGE LRLGIRRAAR PRNGLPDSII EQNSSLNILS  300
LVANAVSTKS MFHVFYSPRA THADFVIPYE KYISSIRNPI CIGTRFRMRF EMDDCPERRC  360
AGVVTGICDL DPYRWPNSKW RCLLVRWDES FVSDNQERVS PWEIDPSVSL TPLSIQSSPR  420
PKRPWSGLLD TPPGNPLTGK YPRLLQHSGH KNGVKLMESI RPSKVLQGQE NIGSASTLQG  480
YDVMNRRILD FAMKSHGNHP LLLSKDRIGE SVDGTDRFPM VLQGQEICSV RAFPHIARKS  540
SLGYTDPFAY QSNKSSFYPL ASHGIRSTQI PYQNPYNVRE KSPGLLPSLT MLETGFVEAR  600
KFEAGNEHSL TKKVAAGDLP FKLGKQQKAD EFSVKGSSGC KLFGFSLPVE TPNLQNSTKR  660
ICTKVHKQGS LVGRAIDLTK LNGYNDLLTE LERLFNMEGL LKDTEKGWRI LYTDSENDMM  720
VVGDDPWHDF CNVVLKIHLY TKEEVEKMNV GNGNLNNDDN KSCLEQDVVL MEVSKSSSVS  780
QT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1125440615354Auxin response factor 1
4ldw_A1e-1125440615354Auxin response factor 1
4ldw_B1e-1125440615354Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400848.10.0hypothetical protein EUTSA_v10012728mg
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLV4N9650.0V4N965_EUTSA; Auxin response factor
STRINGfgenesh2_kg.8__2008__AT5G60450.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM95302636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4